PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv_002120_fpmp.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family NF-YA
Protein Properties Length: 224aa    MW: 24873.2 Da    PI: 10.0491
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv_002120_fpmp.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.81.8e-3373129158
          CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        dep+YVNaKQy++Il+RRq+Rak+e+++kl  k rkpylheSRh hAl+R RgsgGrF
  Bv_002120_fpmp.t1  73 DEPIYVNAKQYHGILRRRQSRAKMEAQNKL-VKIRKPYLHESRHLHALNRVRGSGGRF 129
                        79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.4E-3771132IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.9172132IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.0E-2774129IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.2E-247597IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.2E-24106129IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MDQVKPIYMM DHLDMAYSGG QIDYGRAMTC MPYPCGDPYY NGLLTAYGTT HIQPHMMGIT  60
TARVPLPLDI SEDEPIYVNA KQYHGILRRR QSRAKMEAQN KLVKIRKPYL HESRHLHALN  120
RVRGSGGRFL STKKQQKSDP TSAIRNRSIH GSNALGCIGN NMVFEPHQAQ RMATGTSDVS  180
NGNAFFQQQE GGFLGISSSH TGGGVQRSGA FIHNSNQHQA SVVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-2373144276NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666452.11e-168PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X2
RefseqXP_010666451.11e-168PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
TrEMBLA0A0J8DZ111e-169A0A0J8DZ11_BETVU; Uncharacterized protein
STRINGPOPTR_0006s14740.12e-69(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.12e-43nuclear factor Y, subunit A6